Genemed Synthesis Inc.
Genemed Synthesis Inc.
Excellence by Design, Dedication, and Experience
Saturday March 23, 2019
Sign In     My Cart    My Account    Corporate    Distributors    Customer Service    Toll Free (800) 344-5337
Browse By
New Products
Special Promotions
Request A Catalog
Request Quote
Recently Viewed Items
Join Mailing Lists



Shopping Cart
Qty Catalog# Product Description Product Type Your Price Total
x: Remove item from cart SP-100046-1 Adrenomedullin (1-50), rat (YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2; Disulfide bridge:Cys14-Cys19 ) (MW: 5729.5)
Pure Peptide $245.00 $245.00
Click "Update" after you have made a change in Quantity. Subtotal  $245.00

Enter skus(separated by commas) to
quickly add it to your cart.
Continue Shopping

Genemed Synthesis Inc.| 6203 Woodlake Center Bldg#2 | San Antonio, Texas 78244 USA
Toll Free: (800)-344-5337 | 210-745-5988 | Fax: 210-569-6374| 210-745-5992 | Web: | Contact GSI
Copyright ©2019.  All rights reserved.